PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g08460.1
Common NameLR48_Vigan01g270600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Dof
Protein Properties Length: 233aa    MW: 25277.8 Da    PI: 6.9881
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g08460.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.62.3e-323180252
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52
                    +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrn Pv 
  Vang11g08460.1 31 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRN-PVS 80
                    67899******************************************.554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-212979IPR003851Zinc finger, Dof-type
PfamPF027014.6E-283379IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.7263589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAPGTAGGGG GARFFSGTAS ADRRVRPHHQ NHQALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKNCRRYWT KGGVLRNPVS APINSDSTNM QESKLSVPVD PVLGTNPLEQ GAGDCGGIFS  120
EIGPFTSLIA TSTNEPLGFG FGNGLPDASS FQWQHSKVSS NQELKLAESS FLDHTVDLST  180
LHGKTNHGTF GSLDWQGGAD QGLFDLPNTV DHAYWSHTHW SDHDNSSLFH LP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506030.11e-155PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-30DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A0S3R7J31e-155A0A0S3R7J3_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TRI21e-154A0A0L9TRI2_PHAAN; Uncharacterized protein
STRINGGLYMA05G07460.16e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-32OBF binding protein 4
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]